General Information

  • ID:  hor000041
  • Uniprot ID:  Q95ZN4(22-72)
  • Protein name:  Neuropeptide-like protein 33
  • Gene name:  nlp-33
  • Organism:  Caenorhabditis elegans
  • Family:  YARP (YGGW-amide related peptide) family
  • Source:  animal
  • Expression:  Strongly up-regulated upon D.coniospora infection. |Expressed in hypoderm.
  • Disease:  NA
  • Comments:  Strongly up-regulated upon D.coniospora infection
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0031640 killing of cells of another organism; GO:0050832 defense response to fungus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QWGYGGPYGGYGGGYGGGPWGYGGGWRRRHWGGYGGGPWGGYGGGPWGGYY
  • Length:  51(22-72)
  • Propeptide:  MISTSLLLVVLLFAILAIVDAQWGYGGPYGGYGGGYGGGPWGYGGGWRRRHWGGYGGGPWGGYGGGPWGGYYGK
  • Signal peptide:  MISTSLLLVVLLFAILAIVDA
  • Modification:  T51 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May have antifungic activity against D.coniospora.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95ZN4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000041_AF2.pdbhor000041_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 615859 Formula: C250H303N69O62
Absent amino acids: ACDEFIKLMNSTV Common amino acids: G
pI: 9.58 Basic residues: 4
Polar residues: 36 Hydrophobic residues: 6
Hydrophobicity: -106.86 Boman Index: -1686
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 4144.51 Extinction Coefficient cystines: 46410
Absorbance 280nm: 928.2

Literature

  • PubMed ID:  NA
  • Title:  NA